PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Phvul.003G012400.1
Common NamePHAVU_003G012400g
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Phaseoleae; Phaseolus
Family G2-like
Protein Properties Length: 326aa    MW: 36558.6 Da    PI: 7.7213
Description G2-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Phvul.003G012400.1genomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1G2-like95.83.4e-30210264156
             G2-like   1 kprlrWtpeLHerFveaveqLGGsekAtPktilelmkvkgLtlehvkSHLQkYRla 56 
                         k+r++W+peLH+rFv+a+e+LGGs+ AtPk+i+elm v+gLt+++vkSHLQkYRl+
  Phvul.003G012400.1 210 KQRRCWSPELHHRFVKALEELGGSQ-ATPKQIRELMRVDGLTNDEVKSHLQKYRLH 264
                         79*******************9987.****************************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129413.767207266IPR017930Myb domain
SuperFamilySSF466892.37E-18208267IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.605.8E-29209267IPR009057Homeodomain-like
TIGRFAMsTIGR015571.8E-25210264IPR006447Myb domain, plants
PfamPF002493.7E-8212262IPR001005SANT/Myb domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 326 aa     Download sequence    Send to blast
MNSVPQEQPS LNFRPSFLPK TVTDFLCHLS STPNASLNKS LLQDFLSRLE LELLKIQPFK  60
RELPLCMFLL NDAISALKVE LAKCRTFKSE PVLEEFIPLK KEESEKEEKC REKNDWGSSF  120
QLWNSDDDEA CNRSNAYRLE QKPKKIKGEE RESVKRGFVM PLSTYLATDE ECVVSGLSLQ  180
TPAREGCGSK TSRVVSSATS PLMLPQSGRK QRRCWSPELH HRFVKALEEL GGSQATPKQI  240
RELMRVDGLT NDEVKSHLQK YRLHTRRVPA ATSVDLGGLW MQKESLKGRS SGSPQGPLQL  300
ATQSGEATST TEGDNMVDDD VKSDL*
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAP0150438e-50AP015043.1 Vigna angularis var. angularis DNA, chromosome 10, almost complete sequence, cultivar: Shumari.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_007153166.10.0hypothetical protein PHAVU_003G012400g
TrEMBLV7C7D70.0V7C7D7_PHAVU; Uncharacterized protein
STRINGGLYMA07G29490.11e-161(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF120834107
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G03500.12e-51G2-like family protein